collapse module

Leslie

offline 110 friends
joined on 07/16/06
last updated 06/28/09
collapse module

My Friends

view all 109
collapse module

Leslie's 27 May 08

collapse module

ArchiDelica visionary organic architect

collapse module

My Bio

Gender
Male
Age
55
Location
about me
longtime total raw fooder. much creative cultural orientation. Dharmakara, Amitabha Buddha, Amitayus, Sukhavati, Lemuria, bodhisattva. [Neutralspacetwinflamearchangelicgateway], DAL Universe [messianic merkabah ascension], Pleiadian, Arcturian, Lyran, Maldek, Aldebaran (tree planet), muti-dimensional, {Quan Yin}, GreenTara (Lemurian), aMelchisedek, EL, El*An*Ra (Orion gateway-Lords of Light), Elfin, Eloha, Temple of Solomon, Dead Sea Essene scribe/Emmanuel chronicler, Elders of the Throne, ascended master(3xs+), descended (dark-side perspective), Ursa Major (daemonic gateway), trinitized, QuadimensionalprobabilityIntegrated, evolved, revolved, involved, non-religious, messianic, metatron, surrealist, abused, ironic, complex, capable, once Shivan now Vishnuan, famous/infamous/mundane past & parallel life experience memories, political/apolitical, insightful, perceptive, Aquarian Age visionary, shamanic (Lakota), harmonic, tantric, non-promiscuous, Celtic, arrested development, open-minded, Hermes, Thoth, Thothmes II, White Tara (Persian), enigmatic, resourceful, creatively messy, do-it-yourselfer, big sky, big ideas, big appetite, co-evolved full-integrity liberation facilitator
You are not connected to Leslie
want to grow your network?
view more
collapse module

My Recent Activity

Re: Boast GUSTers (in Year 2012) absinthe & nepenthe are frequently used as chasers in PotatoMan gustatory rituals, ....true enough, .....but in the Modern Rites, these are generally dispensed in Avon Bottles in the likeness of barnyard animals, usually shaped like swine, althou... read more
discussion post on Sat, November 21, 2009 - 12:18 PM
Boast GUSTers (in Year 2012) In a stunning display of Unmistakable Synchromystically Significant visual Sigilism, the heretofore Inscrutable Professor John Hoopes produced and utilized-as-Icon a photo of himself holding the fermented spirit vessel of Mr. Potato Head.... long-... read more
discussion post on Sat, November 21, 2009 - 9:32 AM
Re: Large Hadron Collider Could Re-Start This Weekend (in Quantum Physics) It'll create a French event horizon, which means you should stock up on tacky Kitsch from thrift stores, some $3 wine, Hawaiian Floral shirts, plaid shorts, and books on Western Jingoese.... and chances are you can feed these to the black hole if... read more
discussion post on Fri, November 20, 2009 - 7:55 PM
Re: The Age of the Mayan Calendar II (in Year 2012) Hoopes is here present as a specimen of the Ascientific S'Kept-I-C-All mind, which is pathologically unable to see its own Profound Delusionalities, ....Trapped as That syndrome IS within a Rigid pseudo-logical Framework-fortress of "credible" log... read more
discussion post on Thu, November 19, 2009 - 9:09 AM
Re: SAT 14th Nov (in What Did You Eat Today ???) dreary, 50s, rainy all day, same tomorrow
mostly mental work today
ate about 12 apples, 2 bananas, several tablespoons of organic raw honey and a teaspoon or two of raw cacao together, 8 raw shiitake mushrooms, spirulina, fresh greens, tomato, r... read more
discussion post on Sat, November 14, 2009 - 9:25 PM
Re: This is cool (in SacredGeometry) perhaps double-triple-quadruple the time-expense for possibly 50-1000xs the value-added.... which is a Good Deal. really
discussion post on Sat, November 14, 2009 - 8:26 PM
Re: SAT 14th Nov (in What Did You Eat Today ???) heya pink lady
how does Sunday (midday in spring?) look from your early perspective? (Saturday night here mid-fall)
discussion post on Sat, November 14, 2009 - 8:20 PM
Re: Car Maintenance (in Year 2012) we are under the protection of an ET presence, which possesses ample advanced technology to prevent any sizable asteroid from posing a danger.... protracted and willful ignorance, however, is our own native problem.
discussion post on Sat, November 14, 2009 - 7:50 PM
Re: This is cool (in SacredGeometry) yes, actually, I'd be happy to do something like that, (applied fractal motif-structuralism-architectonically-realized), as adherence to fully 3D fractality strictly-as-generated-by-computation, unmodified by practicality, might be an unnecessari... read more
discussion post on Sat, November 14, 2009 - 6:44 PM
Re: This is cool (in SacredGeometry) I suggest that an initial project be an open structure, something like a pavilion, as working out full enclosure is an added level of challenge & expense...... probably involving extensive use of acrylic. Also, selecting particular elements, rathe... read more
discussion post on Sat, November 14, 2009 - 5:35 PM
Re: SAT 14th Nov (in What Did You Eat Today ???) Pink Lady
discussion post on Sat, November 14, 2009 - 5:11 PM
Re: This is cool (in SacredGeometry) I can create a low-budget, low-tech version of this by sectioning it up into architectonic components and machine carving either positive patterns out of wood, to be assembled, or machining molds, to be assembled, out of a combination of polystyre... read more
discussion post on Sat, November 14, 2009 - 5:06 PM
Re: David Icke: The Global Spiritual Awakening Of Humanity (in Year 2012) >>>>4,000 americans have died of it so far and it is really just getting started.<<<

So you Happen to Know it's "really just getting started"? ....fascinating, this level of certainty .... and we would be delusional for not sharing this su... read more
discussion post on Sat, November 14, 2009 - 2:44 PM
Re: Valum Votan's Vocabulary (in Year 2012) I would do well to invoke my Lemurian Karmic origins, but too much plane talk tends to put things back on a strictly geometric footing, .... and plain folk can't handle the unencumbered starwheel invokations that this may lead to.
discussion post on Sat, November 14, 2009 - 2:32 PM
Re: NASA wasn't on crusade back in 2006 (in Year 2012) No doubt you do, and we don't judge you and yours for that do we? ....... anyone here judging them?
... what if I were an aspie, but with added layers of other things obscuring that aspect of mine?

I think the important thing is that I'm one c... read more
discussion post on Sat, November 14, 2009 - 2:25 PM
Re: Valum Votan's Vocabulary (in Year 2012) oh, see all that Positivity I get from my splenderfluousity associations...... being with positive vibes....... No Wonder! i need to come to this tribe and get snarly with the mad dogs here, just to keep a balance......
(bares teeth arrarrggggh... read more
discussion post on Sat, November 14, 2009 - 2:10 PM
Re: NASA wasn't on crusade back in 2006 (in Year 2012) ooooooooooo, Bill Gates..... that's gotta sting !

but yeah, super-rational lefthemispherical introversional (the good with the bad, that)

then there just the smartass raw vegans, like me and Leonardo Da Vinci, crankin' right hemisphere & ... read more
discussion post on Sat, November 14, 2009 - 1:59 PM
Re: Crib Notes on 2012 (in Year 2012) I'm Sure, there Both Thrilled that they will be Linked ToGether in this way,
forever,
and ever,
and ever,
and ever......
discussion post on Sat, November 14, 2009 - 1:41 PM
Re: Valum Votan's Vocabulary (in Year 2012) best not to "use hypoten" when intuiting absterfractals, unless you don't mind a lot of square roots elbowing your Beziers and Nurbs and such. Also can spoil the Logo-rhythm empo-templo-sions, ..........but that's where the rubber meets the graphi... read more
discussion post on Sat, November 14, 2009 - 1:34 PM
Re: Valum Votan's Vocabulary (in Year 2012) Oh yeah, I can relate, in a roundabout way .... but can't completely understand the particulars, so your preference remains safe enough.
(I 'm visualizing some furniture-sculpture I could make on my CNC router table..... thanks for a bit of inspi... read more
discussion post on Fri, November 13, 2009 - 5:56 PM
Re: Carnival of Bunkum (in 2012 Galaxy Heart Tantra) The article makes some sense, and also some nonsense. I'd "Let Go" of it as the maniacal ravings of a close-minded rationalist, but that's just me,.................... knowing from experience that there's a Lot More than Bunkum afoot and ahead.
... read more
discussion post on Fri, November 13, 2009 - 2:53 PM
Re: Will Our Universe Collide With a Neighboring One? by Zeeya Merali (in Year 2012) Universes are created from higher dimensions of consciousness. Time ITself is an Artifact which is an Aspect of lower dimensions. From a higher dimension of consciousness, one could approach the 'proverbial beginning' of the universe and see that... read more
discussion post on Fri, November 13, 2009 - 2:38 PM
Re: Open Source Society (in Year 2012) I've Had It with Windows!!!!
No doubt, some of my seeming Anger comes from an Unending stream of Windows Problems which has continued for.................... ever since I got a computer back in the 90s! MicroSoft is Corrupt. It Deliberately... read more
discussion post on Fri, November 13, 2009 - 2:19 PM
Re: Valum Votan's Vocabulary (in Year 2012) now divide by 1000 the volume and backwards engineer to get the proto-raindrops diameters,.... to thereby get a measurable ratio of these to the singular drop-globnormous one.
discussion post on Fri, November 13, 2009 - 2:05 PM
Re: Decode a Birthdate (in Year 2012) I accept that I KNOW certain things which are Obscure for most. That others Lack such self-knowledge and seem Compelled to "blindly accept" this or that from others is really an Issue of their own Ignorances..... especially when the Eloquences ne... read more
discussion post on Fri, November 13, 2009 - 2:01 PM
Re: Decode a Birthdate (in Year 2012) maybe it's BS, maybe It isn't bs

I say 'let it be', (as opposed to Passing final judgment) unless it becomes a Real Problem for you by way of interference.

It does get to be IRRITATING that "because it is vague and indiscernible, Let's call ... read more
discussion post on Fri, November 13, 2009 - 1:40 PM
Re: Decode a Birthdate (in Year 2012) I could, but why Bother?, I mean Really, I have WORK to do before the snows come, and I sense a disingenuousness...... of feigned interest with-the-intent-to-diminish any such attempt
discussion post on Fri, November 13, 2009 - 10:14 AM
Re: Decoding frames-of-mind (in Year 2012) possibly there are Some who (by way of Function, either inadvertently, or with every awareness) Only, or mostly, or in larger part "find meaning" in the Act of DeMeaning Others, not that we all don't periodically indulge a wee bit, ............. b... read more
discussion post on Fri, November 13, 2009 - 10:11 AM
Decoding frames-of-mind (in Year 2012) It's intended to be a systematic tool to distribute & mix archetypes in a roughly even manner across the population..... ostensibly getting its validity by synchrony with the Mayan Calendar. You can play along, much like working with the I-Ching ... read more
discussion post on Fri, November 13, 2009 - 9:58 AM
Re: Valum Votan's Vocabulary (in Year 2012) you turned out to be as precious as punque. if only you could find the formula for the volume of a sphere, all 144,000 of your kin could be kissing raindrops.
discussion post on Fri, November 13, 2009 - 8:13 AM
view all 31
collapse module

My Blog

Embracing things as they are yes but reaching towards an awesome living potential. Knowing the match of living food and my/our living selves is a primal pairing that can no longer be disrupted. Started total raw in 1990 after years of trying/failing to get there. True 7 years then 5 years less-than-total in the face of old habit and no raw friends. The Boutenkos got me back into total raw over three years ago. Grace is flowing back into my existence. I see hope where I was blindly chasing... read more
Mon, July 17, 2006 - 9:01 AM permalink - 2 comments
 
view all 1
collapse module

My Testimonials

March 16, 2008
Leslie is a really good Cobber.

Not just down under.
I'm talking 'everywhere'.

And I owe him a beer (or herb tea).
view all 1